Bacterial taxon 909946
Locus STM474_1516
Protein WP_000949152.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 132 aa, Gene rspB, UniProt E8XI86
>WP_000949152.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLSIVVDKTYSPGVIMAALIVIHNFAVLGLFALENITMAEIFGSRNRFTRMAISKEAGGLVAVGFGPVLAGIFCNMTDSWLPILIMLVLYSCIGLISALLMPEVRDRDLSLPEDAAEATAAEKLRHSATQTS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,542,708 | 0.47 | 0.92 | ○○○○○ 0.42 | 0.420128693400489 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,542,708 | 0.64 | 0.64 | ○○○○○ 0.51 | 0.509654362751997 | 23637626 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)