Bacterial taxon 909946
Locus STM474_1596
Protein WP_001526408.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 70 aa, Gene n/a, UniProt E8XJ31
>WP_001526408.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSINKIAQRHTFSGENENNRRNGLILCCFNIVRWFIVRGHIYDHKSLQGLTLINYCATQSLPICAGVLSG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,627,204 | -0.36 | 0.68 | ●○○○○ -0.01 | -0.00779025281788124 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,627,204 | 1.22 | 0.61 | ○○○○○ 0.81 | 0.8120148567369 | 23637626 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)