Bacterial taxon 909946
Locus STM474_2031
Protein WP_014343854.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 80 aa, Gene n/a, UniProt E8XB21
>WP_014343854.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKNVSPSYAFSARRGGQGWCYFYFSIISQLLVFCPALSPYPIWINIDVTRGDLTPSSSVIVAPGLLPDMFPCRHGRRAED
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,039,471 | -3.62 | 1.1e-10 | ●●○○○ -1.7 | -1.70051483716623 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,039,471 | -1.32 | 0.4 | ●○○○○ -0.51 | -0.510363752782086 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,039,471 | -1.1 | 0.46 | ●○○○○ -0.39 | -0.392233848381675 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)