Bacterial taxon 909946
Locus STM474_2038
Protein WP_000605050.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 137 aa, Gene n/a, UniProt E8XB26
>WP_000605050.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MILYVNGIRKDATASLDFLTRAVVISLFTWRRAERDDRTPQPYGWWGDTWPAVQNDRIGSRLYLLKRRKLTNKTPQDAREYMQQALAWMTDDGVAARIDVTSERTGTDTLAAGVTIYQRDGVIHNITFDDIWSKLNG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,045,599 | -0.51 | 0.48 | ●○○○○ -0.09 | -0.0885563603164933 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,045,599 | 0.17 | 1 | ○○○○○ 0.27 | 0.267320863434809 | 23637626 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)