Bacterial taxon 909946
Locus STM474_2054
Protein WP_000605609.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 60 aa, Gene n/a, UniProt E8XB42
>WP_000605609.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCMFWSWLVARYLDRTQQSVGGGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,058,438 | 0.25 | 0.97 | ○○○○○ 0.31 | 0.306761483001894 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,058,438 | 0.53 | 0.2 | ○○○○○ 0.45 | 0.450497407197624 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,058,438 | 0.92 | 0.42 | ○○○○○ 0.66 | 0.655974703402142 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)