Bacterial taxon 909946
Locus STM474_2069
Protein WP_000620702.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 74 aa, Gene n/a, UniProt E8XB56
>WP_000620702.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MIRNIFKRFTSQRFHCPRPGQWYSTPEGYVLRISLVDRECQKVVCEPLGRNYRVNMPLIAFRSGKNMKHLGGAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,069,979 | -0.99 | 0.62 | ●○○○○ -0.33 | -0.334875686853763 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,069,979 | -0.55 | 0.27 | ●○○○○ -0.11 | -0.107704473040125 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,069,979 | 0.89 | 0.44 | ○○○○○ 0.64 | 0.64046406417937 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)