Bacterial taxon 909946
Locus STM474_2071
Protein WP_000509731.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 184 aa, Gene n/a, UniProt E8XB58
>WP_000509731.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MGHEPEWKVEKQPRWLVAAIKKTISSLHGGYEEAAEWLDVTKDALFNRLRTGGDQIFPIGWALVLQRAGGTYHLAHSVARASGGVFVPLADMEEVDNADINQRLLEAIEQITSYSQQIRVAIEDGVIEPHEKAVIDEELYQAIAKLQQHSTLVYRVFCAPEKGDARECAAPGAVASNFMEKTNA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,071,479 | 0.12 | 0.89 | ○○○○○ 0.24 | 0.237766877578561 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,071,479 | 0.28 | 0.86 | ○○○○○ 0.32 | 0.324463531164138 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,071,479 | 1.06 | 0.7 | ○○○○○ 0.73 | 0.72555176183184 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)