Bacterial taxon 909946
Locus STM474_2073
Protein WP_000997190.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 123 aa, Gene n/a, UniProt E8XB60
>WP_000997190.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MNDDRMTVVPDFLGELDAGVFMNKIAAALNTVGLGVLNNGNKGKVVLTFDFERMGNSVEEKRVKIKHKLQYSTPTPRGKASEEDTTETPMWVNKGGKLTILQEDQGQLFSIKGTTDGKLKAAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,074,087 | -0.79 | 0.22 | ●○○○○ -0.24 | -0.235071891117519 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,074,087 | -0.11 | 0.94 | ○○○○○ 0.12 | 0.118243026003674 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,074,087 | 1.65 | 0.37 | ○○○○○ 1.03 | 1.03281711482039 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)