Bacterial taxon 909946
Locus STM474_2341
Protein WP_001554888.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 48 aa, Gene n/a, UniProt E8XDT6
>WP_001554888.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLYLLSFIRMIIVFSAEIVQICHIVKRVNFTLISAWVSSKTCDRRVIS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,344,309 | -3.43 | 1.1e-10 | ●●○○○ -1.6 | -1.60208764608931 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,344,309 | -3.09 | 0.0023 | ●●○○○ -1.43 | -1.4257194829601 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,344,309 | -1.89 | 0.12 | ●○○○○ -0.8 | -0.804010772018449 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)