Bacterial taxon 909946
Locus STM474_2384
Protein WP_001112763.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 58 aa, Gene n/a, UniProt E8XED0
>WP_001112763.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MPDGTYALRMRFSAYRYSLAIRQEVCAVMALNMLRRWLNGEDITSEHGWIDVVESLTA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,393,700 | -1.68 | 0.0015 | ●○○○○ -0.7 | -0.695263418626585 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,393,700 | -1.03 | 0.6 | ●○○○○ -0.36 | -0.357371182316369 | 23637626 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)