Bacterial taxon 909946
Locus STM474_2474
Protein WP_000118256.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 122 aa, Gene n/a, UniProt E8XF30
>WP_000118256.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSWDKRMAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGDVIIIQPYAGGNPSGHMAIYDGTEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,484,742 | -4.15 | 3.6e-14 | ●●○○○ -1.98 | -1.98044232534839 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,484,942 | -1.38 | 0.0078 | ●○○○○ -0.54 | -0.541520573928124 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,484,742 | -1.7 | 0.21 | ●○○○○ -0.71 | -0.705316801698217 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,484,942 | -1.14 | 0.79 | ●○○○○ -0.41 | -0.412901450017352 | 23637626 |
Retrieved 4 of 4 entries in 1.2 ms
(Link to these results)