Bacterial taxon 909946
Locus STM474_2497
Protein WP_000279836.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 72 aa, Gene pgtC, UniProt E8XF52
>WP_000279836.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MAVLSLACADINKFAASDLIRFIDVFGRRTRYYSNNVVLDANRNKRVSFVSIFSLCDIDIYERDHKSTFLML
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,509,458 | -3.71 | 0.00031 | ●●○○○ -1.75 | -1.75166679723663 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,509,458 | -0.97 | 0.66 | ●○○○○ -0.33 | -0.326436469999849 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,509,458 | -0.55 | 0.33 | ●○○○○ -0.11 | -0.106318651063796 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)