Bacterial taxon 909946
Locus STM474_2608
Protein WP_001526273.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 63 aa, Gene n/a, UniProt E8XGJ6
>WP_001526273.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MTGKTINSLQLSSTNNLGRFVGRNVPWLGWVMTFTTIYDIQRNIKDTFNRVAVPKDRIKWTYF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,619,507 | -1.86 | 0.16 | ●○○○○ -0.79 | -0.791190387667779 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,619,507 | -1.28 | 0.083 | ●○○○○ -0.49 | -0.485943935057633 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,619,507 | 1.66 | 0.47 | ○○○○○ 1.04 | 1.03875785713262 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)