Bacterial taxon 909946
Locus STM474_2620
Protein WP_000406466.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 73 aa, Gene yfgJ, UniProt E8XGK7
>WP_000406466.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MEITCPVCHHALERNGDTAHCETCAKDFSLQALCPDCRQPLQVLKACGAVDYFCQNGHGLISKKRVNFVISDQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,648,908 | 0.74 | 0.53 | ○○○○○ 0.56 | 0.563179612915046 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,648,908 | 1.13 | 0.66 | ○○○○○ 0.76 | 0.763783910074133 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,648,908 | 1.19 | 0.14 | ○○○○○ 0.8 | 0.797340211392899 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)