Bacterial taxon 909946
Locus STM474_2626
Protein WP_001533207.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 40 aa, Gene yfgA, UniProt E8XGL3
>WP_001533207.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MAQCQLNNVWRCTCLVNNNGAFLSTLRQYVMVQQEFSLVS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,656,355 | 0.87 | 0.32 | ○○○○○ 0.63 | 0.631376467834397 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,656,355 | 1.58 | 0.24 | ○○○○○ 1 | 0.997816293382225 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,656,355 | 2.26 | 0.13 | ○○○○○ 1.35 | 1.35103436661672 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)