Bacterial taxon 909946
Locus STM474_2731
Protein WP_014343878.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 82 aa, Gene n/a, UniProt E8XHK3
>WP_014343878.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSNSALQKSEDSWYDIVRRSDGCVVFSFPSSGRHLIYRVNGMVSMRPLLDDEEVFTPNGFMHFIRRLGYRVTPPSDNMKSTA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,762,976 | -1.15 | 0.12 | ●○○○○ -0.42 | -0.418112917106948 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,762,977 | -1.05 | 0.16 | ●○○○○ -0.37 | -0.366653388218364 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,762,976 | -0.15 | 0.97 | ○○○○○ 0.1 | 0.101683143581779 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,762,976 | -0.06 | 0.97 | ○○○○○ 0.15 | 0.145712347542327 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,762,977 | 0.51 | 0.91 | ○○○○○ 0.44 | 0.440124717237141 | 23637626 |
Retrieved 5 of 5 entries in 1.9 ms
(Link to these results)