Bacterial taxon 909946
Locus STM474_2796
Protein WP_000416621.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 229 aa, Gene n/a, UniProt E8XIF0
>WP_000416621.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MEKVIIKLDRRWELAEFAVFTKEYLQLYGFFYALQSRSKEVTSPTEKDGEVWGYSTMPWEGGHSVVNFFRGVYTSTPPEYRPVVKKIQYASPGFIELSALTDIAWQIAELVAAVAASILTANKVYDRVMRTYRQREWAKLKSDKLRLQNQEREIQLVANSVKALEKVMGLSEEQHKYLVRLSGADELVQLKMLLAVFRRATPLAELQESGKADFKGENDKDGKAPQHKN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,825,245 | -1.14 | 0.29 | ●○○○○ -0.42 | -0.417411377964328 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,825,578 | -0.26 | 0.75 | ○○○○○ 0.04 | 0.0406104666559926 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,825,245 | 0.63 | 0.87 | ○○○○○ 0.51 | 0.505293920067182 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,825,578 | 1.36 | 0.38 | ○○○○○ 0.89 | 0.885882219724318 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,825,578 | 1.64 | 0.39 | ○○○○○ 1.03 | 1.02745936092801 | 23637626 |
Retrieved 5 of 5 entries in 1.4 ms
(Link to these results)