Bacterial taxon 909946
Locus STM474_2804
Protein WP_001287923.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 201 aa, Gene n/a, UniProt E8XIF8
>WP_001287923.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSEDYVIEWDKNFADDLNVVANVFLSHNPTLWPTIFSQLSTQPEIFEDEDEDEYGLQDVLDCSGGDLGNNELAQAFLQVLRGEGFIHLVDWKGEDEEGELANFAADRFYELTKNLTDSEELRNLLVEITQEDEISDVCEAGDRYLDEIFERIQTELNKRGFQIFDLNEGSDTYNVVVLPMSEYKKIEDFNTPWLEVQDFLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,832,314 | 0.32 | 0.98 | ○○○○○ 0.34 | 0.343604128884421 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,832,314 | 0.82 | 0.81 | ○○○○○ 0.6 | 0.600675361456034 | 23637626 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)