Bacterial taxon 909946
Locus STM474_2850
Protein WP_014344394.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 369 aa, Gene n/a, UniProt E8XJ75
>WP_014344394.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLSYSNVLCRIPTEKDGTMSLSYVEFGKVDLSDVFFDSLKNDYPAFENWFLKKRNEKAYVSYDDYGKIDGFLYLKIENEELNDMTPSFPMKKRLKCGTFKIDARGTKMGERFVRKIFDFAMPHDIQEVYVTIFDKHQGLIGLLERYGFKLCSRKNLETENGCEGVYFKNFNWKSSSASAYDNYPMIKMNERNFLLAIKPEFHSKLFPESILRNENDSILEDVTYTNSIHKIYIGAMKGMEFLQPGDNILIYRTSDGLGPAKYRSVATSVCTLQEYKNIREFPSYNEFKSYCGGASIFSDEELQAYYRKGYPPHVIKLTYNFPLRKRIIRDELLNVLGYTPSYSGFFTLSDVHFKAVLSAGKVNENFIVD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,879,764 | -6.18 | 1.0e-23 | ●●●●○ -3.03 | -3.03399644011148 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,879,864 | -5.29 | 5.6e-7 | ●●●○○ -2.57 | -2.56817945197063 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,879,997 | -3.52 | 0.00051 | ●●○○○ -1.65 | -1.65131126492123 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,880,158 | -3.48 | 0.00015 | ●●○○○ -1.63 | -1.62763214111152 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,879,764 | -2.68 | 0.023 | ●●○○○ -1.22 | -1.21690384165072 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,879,864 | -2.62 | 2.1e-7 | ●●○○○ -1.18 | -1.18283311080313 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,880,158 | -2.32 | 4.4e-7 | ●●○○○ -1.03 | -1.02695357268367 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,880,526 | -1 | 0.05 | ●○○○○ -0.34 | -0.342668900081471 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,880,475 | 1.37 | 0.05 | ○○○○○ 0.89 | 0.890358269656063 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,879,864 | -1.75 | 0.18 | ●○○○○ -0.73 | -0.730432595146669 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,879,997 | -1.47 | 0.32 | ●○○○○ -0.59 | -0.588679384440859 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,879,997 | -1.15 | 0.099 | ●○○○○ -0.42 | -0.42153382078912 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,879,764 | -1 | 0.61 | ●○○○○ -0.34 | -0.342055230547827 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,880,158 | -0.68 | 0.87 | ●○○○○ -0.18 | -0.175174712666855 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,880,526 | -0.53 | 0.9 | ●○○○○ -0.1 | -0.0993797848164631 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,880,475 | 0.42 | 0.86 | ○○○○○ 0.4 | 0.395948531630708 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,880,526 | 0.85 | 0.51 | ○○○○○ 0.62 | 0.619510815557889 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,880,475 | 0.91 | 0.77 | ○○○○○ 0.65 | 0.651392859713777 | 23637626 |
Retrieved 18 of 18 entries in 0.7 ms
(Link to these results)