Bacterial taxon 909946
Locus STM474_2857
Protein WP_000794278.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 91 aa, Gene n/a, UniProt E8XJ82
>WP_000794278.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKNNEQQNEALKQLTNVLTEAGNQTRVDVLAHSILLQAIFSVLSEEQKNQIIKILQTATVNQHAATAGVEAEVKMSLAQLLSGFLTPQKLN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,885,662 | -6.45 | 3.8e-23 | ●●●●○ -3.17 | -3.17137086853305 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,885,662 | -4.41 | 5.5e-5 | ●●●○○ -2.11 | -2.11446272120597 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,885,662 | -2.84 | 0.0089 | ●●○○○ -1.3 | -1.29682977790293 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)