Bacterial taxon 909946
Locus STM474_2857
Protein WP_000963476.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 113 aa, Gene n/a, UniProt E8XJ82
>WP_000963476.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MAIEGAAATVPLSPGQRMEGLNRIAELRANVFGLNIEPELERFIKDMRDRRDINHKQNERALAAIFFMAKIPAERHGVNISDLTTDEKRELVKAMNHFRAVVSLFPKRLTMPN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,885,318 | -6.87 | 3.0e-9 | ●●●●○ -3.39 | -3.38800213617425 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,885,318 | -2.56 | 4.2e-7 | ●●○○○ -1.15 | -1.15123956311293 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,885,318 | -2.05 | 0.084 | ●○○○○ -0.89 | -0.886872499817355 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)