Bacterial taxon 909946
Locus STM474_2865
Protein WP_000562051.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 86 aa, Gene n/a, UniProt E8XJ90
>WP_000562051.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MIASLLANEYVSAFGYIVGVISGCIAIYQTTQVTKKNNEIKQLNVTIKDLNSQIINITTNRNNINQGERSQYFQDNNGPVNIDNRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,893,918 | -2.04 | 0.049 | ●○○○○ -0.88 | -0.881482876619088 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,893,918 | -1.66 | 0.00094 | ●○○○○ -0.68 | -0.683903668731155 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,893,918 | 0.53 | 0.9 | ○○○○○ 0.45 | 0.450315177584271 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)