Bacterial taxon 909946
Locus STM474_2871
Protein WP_001216603.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 75 aa, Gene n/a, UniProt E8XJ96
>WP_001216603.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MRHTTITARDLECLEHMRNVGQLVNELMQVQDCATVRRDPVQQSQLTSVIYLMTAQLDGVVERCNQRWLTGEGNV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,897,391 | 0.02 | 0.93 | ○○○○○ 0.19 | 0.189813618884163 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,897,391 | 0.79 | 0.5 | ○○○○○ 0.59 | 0.58649937924588 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,897,391 | 1.43 | 0.5 | ○○○○○ 0.92 | 0.91718509657809 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)