Bacterial taxon 909946
Locus STM474_2872
Protein WP_000795388.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 106 aa, Gene n/a, UniProt E8XJ97
>WP_000795388.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKNPLPPVLRAALYRRAVACAWLTLCERQHRYPHLTLDALESAIAAELEGFYLRQHGEEKGRQIACALLEDLIEAGPLKAAPSLSFLGLTVMDELCARHITAPVLH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,897,790 | 0.04 | 0.95 | ○○○○○ 0.2 | 0.199335413229917 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,897,790 | 0.13 | 1 | ○○○○○ 0.24 | 0.244644167121313 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,897,727 | 0.9 | 0.23 | ○○○○○ 0.64 | 0.642351377996839 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,897,727 | 1.22 | 0.61 | ○○○○○ 0.81 | 0.810294917015836 | 23637626 |
Retrieved 4 of 4 entries in 1.5 ms
(Link to these results)