Bacterial taxon 909946
Locus STM474_2907
Protein WP_001530982.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 60 aa, Gene hin, UniProt E8XJD2
>WP_001530982.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSERLFAKLSLIIHGRLVCESSSPILALCLCDHTRVNKPETKLHRLTLSSFPIFTQKIIT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,938,804 | -1.06 | 0.34 | ●○○○○ -0.37 | -0.372228502326442 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,938,804 | 1.12 | 0.17 | ○○○○○ 0.76 | 0.757756441164636 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,938,804 | 2.23 | 0.9 | ○○○○○ 1.33 | 1.33485454623237 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)