Bacterial taxon 909946
Locus STM474_2912
Protein WP_014343883.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 110 aa, Gene iroN, UniProt E8XK19
>WP_014343883.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MFEKENAMPGCISACSCVVSSTPPDPKAPPKPKWIELKGYCVTCTSQEDIRPPKEGEPKQKMTPRDLVLLRGLLKDLGVTQNPWQDPTVKPNNCGLPYFPVVPGERETDV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,949,044 | -4.39 | 6.7e-5 | ●●●○○ -2.1 | -2.10316216384123 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,949,044 | -2.67 | 0.016 | ●●○○○ -1.21 | -1.21058646166223 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,949,044 | -1.64 | 0.0047 | ●○○○○ -0.67 | -0.672278190166098 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)