Bacterial taxon 909946
Locus STM474_2934
Protein WP_000494942.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 59 aa, Gene n/a, UniProt E8XK40
>WP_000494942.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MFTPGDIVQPRMGGPKLKVIEVNEDHIVAVQVGNEPGEKLILKAADVTPYCEEGDFGVC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,969,700 | -0.42 | 0.59 | ●○○○○ -0.04 | -0.0405471007996894 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,969,700 | 0.14 | 1 | ○○○○○ 0.25 | 0.25192520931993 | 23637626 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)