Bacterial taxon 909946
Locus STM474_2968
Protein WP_001519391.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 81 aa, Gene ygaD, UniProt E8XK69
>WP_001519391.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSLKKTESTQHKLKQTCQLRLWLIVGGVCSLGMGVLNILSSGYFEPYDGGQIILGLGCLGYSLALSKKISHLQAENQPKKP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,999,400 | -1.52 | 0.14 | ●○○○○ -0.61 | -0.614067968200533 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,999,400 | -0.59 | 0.4 | ●○○○○ -0.13 | -0.130939497594555 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,999,400 | 0.51 | 0.96 | ○○○○○ 0.44 | 0.443937153061129 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)