Bacterial taxon 909946
Locus STM474_3048
Protein WP_000858988.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 173 aa, Gene n/a, UniProt E8XL36
>WP_000858988.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKTTLSQPFIINKLSINVKPALSRSGKIVFEANPAQKLYTVFDDHREAPAGFGVKASLTKKTYVIQRRVASSDRNVSEGRKPSSVLKVKVGNVFDFPNIDETRQAARQLVQTMLATKRNFNKIKRETDASELETVIKIVLHEGKPIHFATTVIAFSSDRYLELCDLYSSQAIE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,072,367 | -0.94 | 0.41 | ●○○○○ -0.31 | -0.31074980957123 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,072,367 | -0.76 | 0.34 | ●○○○○ -0.22 | -0.219047208216767 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,072,367 | 0.76 | 0.92 | ○○○○○ 0.57 | 0.570289701900191 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)