Bacterial taxon 909946
Locus STM474_3063
Protein WP_000562964.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 78 aa, Gene n/a, UniProt E8XL51
>WP_000562964.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MICPRCADAHIELMATSPVKGVWTVYQCQHCLYTWRDTEPLRRTSREHYPQAFRMTQKDIDDAPMVPSIPPLLAEDKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,087,851 | 0.89 | 0.78 | ○○○○○ 0.64 | 0.639194727091853 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,087,851 | 1.27 | 0.66 | ○○○○○ 0.84 | 0.836138766855264 | 23637626 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)