Bacterial taxon 909946
Locus STM474_3194
Protein WP_000465741.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 78 aa, Gene ygfy, UniProt E8X9L8
>WP_000465741.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MFFLPRENEVPGYCNVFLALFYGNLSNLERDREIKGWESICSSILDTASQNDQSALNGLFKALAMTDGSFTINHYCCS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,227,544 | -3.49 | 1.5e-11 | ●●○○○ -1.64 | -1.6359010798611 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,227,544 | -2.21 | 0.001 | ●○○○○ -0.97 | -0.970706641318091 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,227,544 | -0.68 | 0.79 | ●○○○○ -0.18 | -0.17557154181884 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)