Bacterial taxon 909946
Locus STM474_3211
Protein WP_001112716.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 83 aa, Gene argP, UniProt E8X9N5
>WP_001112716.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MPDGGVNVLSGLHDPLFPRHFFEVHHKIIAFRRQKTTRHWLFFAGDKAIQNAHRISKSSFQCVIRSKKREHREKTRPGSAQAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,247,216 | -1.55 | 4.4e-5 | ●○○○○ -0.63 | -0.627720342513464 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,247,216 | 0.57 | 0.68 | ○○○○○ 0.47 | 0.471089381030276 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,247,216 | 1.07 | 0.71 | ○○○○○ 0.73 | 0.73284291716536 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)