Bacterial taxon 909946
Locus STM474_3217
Protein WP_014344170.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 66 aa, Gene epd, UniProt E8X9P1
>WP_014344170.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSSRRRQLSDLHHISWPLTLQFIPYLRITSTSVRSFHRRVTNTDLYQKALSPASILSAPRPSLGVL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,253,846 | -1.85 | 0.011 | ●○○○○ -0.78 | -0.784426420387178 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,253,846 | 0.1 | 1 | ○○○○○ 0.23 | 0.229131788194221 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,253,846 | 0.63 | 0.66 | ○○○○○ 0.5 | 0.502240376503757 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)