Bacterial taxon 909946
Locus STM474_3235
Protein WP_001540881.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 54 aa, Gene yqgB, UniProt E8XAD7
>WP_001540881.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MGITSAGMQSRDADCGGHARTRTMRQIQQNTTVHYLVSPPRPPRKTNPQAKATF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,271,888 | -1.17 | 0.022 | ●○○○○ -0.43 | -0.432353974125653 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,271,888 | -1.95 | 0.11 | ●○○○○ -0.84 | -0.837905085423054 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,271,888 | -1.42 | 0.17 | ●○○○○ -0.56 | -0.562094074178155 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)