Bacterial taxon 909946
Locus STM474_3262
Protein WP_012219228.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 74 aa, Gene speC, UniProt E8XAG3
>WP_012219228.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MREISPASMGLAGMNIAPLYCLHCRLTARGLPLSFLFLSSPLCGEGSARSLQDNSKIRNSLFLLMSGGRSWYPV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,295,850 | -1.66 | 0.09 | ●○○○○ -0.69 | -0.68615053373189 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,295,850 | -0.69 | 0.26 | ●○○○○ -0.18 | -0.180816587798387 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,295,850 | 0.54 | 0.9 | ○○○○○ 0.46 | 0.458004870095898 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)