Bacterial taxon 909946
Locus STM474_3399
Protein WP_022562449.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 76 aa, Gene tdcA, UniProt E8XC62
>WP_022562449.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MNDCPRRYTRKKAAYRSVSPLHKIRFGGFLLIRPVKGIEVAEDASVTIRQLIDSRGDIILFVFVMRNTKRYVLRYF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,434,775 | -1.05 | 0.049 | ●○○○○ -0.37 | -0.370189393854241 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,434,775 | -0.53 | 0.85 | ●○○○○ -0.1 | -0.100141017109165 | 23637626 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)