Bacterial taxon 909946
Locus STM474_3428
Protein WP_000380404.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 147 aa, Gene yhbP, UniProt E8XC87
>WP_000380404.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MDTLTAIGRWLAKQHVVTWCVHHEGELWCANAFYLFDAQNVALYLLTDDKTRHAQMSGACAPVAGTVNGQPKTVARIRGVQFKGEIRRLEGQESDAARKAYLRRFPVARVLPAPVWEIRLDEIKFTDNTLGFGKKLHWLRDSRAQQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,459,117 | -0.13 | 0.97 | ○○○○○ 0.11 | 0.111170934238139 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,459,117 | 0.48 | 0.41 | ○○○○○ 0.43 | 0.428804618059396 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,459,117 | 1.46 | 0.39 | ○○○○○ 0.93 | 0.933687825298895 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)