Bacterial taxon 909946
Locus STM474_3510
Protein WP_023893148.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 232 aa, Gene n/a, UniProt E8XD53
>WP_023893148.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSEMVAFRQGTSMPSRETILHYVVETVNQITELEPALHLLPWSGVNSAIYEQRFAQCYDEGLCAAQTSAPNVPQGILPSTDWAQGIGLLCFAAGYMSAGERPLTHNQLCDFVKQAAVGLSPIEGEAASGFSTVRSIALPVFRRLQRDGHASRVLLLQTLLHLVAWKSASQYARQQAQRLLWMGGILGEGGEHSLLVLDKALREEAVGEKSLPALLIFTSFLAHFPAGPVFID
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,539,814 | -1.91 | 0.00047 | ●○○○○ -0.81 | -0.81466122784451 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,539,814 | -0.06 | 0.98 | ○○○○○ 0.14 | 0.144418891921156 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,539,814 | 0.89 | 0.6 | ○○○○○ 0.64 | 0.641362939800619 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)