Bacterial taxon 909946
Locus STM474_3523
Protein WP_001103887.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 90 aa, Gene yhcO, UniProt E8XD66
>WP_001103887.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MNVYTFDFNDIKNQSDFYREFTQTFGLASEKVSDLDTLWDAVMSDILPLPLEIEFVHLPDKLRRRYGALILLFDEAEEELEGRLRFNVRH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,551,055 | 0.27 | 0.75 | ○○○○○ 0.32 | 0.316587201615108 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,551,055 | 0.4 | 0.94 | ○○○○○ 0.39 | 0.386713964026145 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,551,017 | 0.77 | 0.82 | ○○○○○ 0.58 | 0.575787572617143 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,551,017 | 0.92 | 0.17 | ○○○○○ 0.66 | 0.656200885217027 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,551,017 | 1.13 | 0.65 | ○○○○○ 0.76 | 0.761941106202208 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,551,055 | 3.05 | 0.15 | ○○○○○ 1.76 | 1.76112318452492 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)