Bacterial taxon 909946
Locus STM474_3609
Protein WP_001675269.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 63 aa, Gene bfd, UniProt E8XDY8
>WP_001675269.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLKFWANYSLISFELKRALRRPFCCLLFSRCYIYSPFLTLLPWRKSLCAIVIITILIYTLCGN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,619,761 | -1.19 | 0.66 | ●○○○○ -0.44 | -0.443167295877013 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,619,761 | -1.11 | 0.31 | ●○○○○ -0.4 | -0.398466935800995 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,619,761 | -0.75 | 0.22 | ●○○○○ -0.21 | -0.212446188393877 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,619,756 | -0.11 | 0.97 | ○○○○○ 0.12 | 0.120373479338974 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,619,756 | 0.45 | 0.51 | ○○○○○ 0.41 | 0.413274976591616 | 23637626 |
Retrieved 5 of 5 entries in 1.3 ms
(Link to these results)