Bacterial taxon 909946
Locus STM474_3733
Protein WP_001517957.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 44 aa, Gene n/a, UniProt E8XF78
>WP_001517957.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MTAGRSAKRKPDGADAYPAYMPGEKIKTTSQFSKNFALQAGGKL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,755,666 | -0.54 | 0.89 | ●○○○○ -0.1 | -0.102440690185393 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,755,666 | 0.73 | 0.16 | ○○○○○ 0.56 | 0.557065976710232 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,755,666 | 1.56 | 0.27 | ○○○○○ 0.99 | 0.988601362105946 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)