Bacterial taxon 909946
Locus STM474_3795
Protein WP_001541613.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 86 aa, Gene n/a, UniProt E8XFD9
>WP_001541613.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MPPGIKPPQHCASPGKPGLLLILRQNPRPGTALTCNLRDASQTITFICQNTFSISEAGSQPLNSVNYASSRPVPVIPKPSFSILRL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,829,928 | -0.37 | 0.91 | ●○○○○ -0.01 | -0.0126879613771189 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,829,928 | 0.17 | 0.74 | ○○○○○ 0.27 | 0.266255969128581 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,829,928 | 0.78 | 0.66 | ○○○○○ 0.58 | 0.581330753543624 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)