Bacterial taxon 909946
Locus STM474_3822
Protein WP_000047149.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 179 aa, Gene n/a, UniProt E8XFW5
>WP_000047149.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSKSSWLLLLGLCASGSALAASSESAFLAQHGLAGKTVEQIVDTIDQTPQSRPLPYSASITSTELKLSDGEQIYTLPLGDKFYLSFAPYEWRTHPCFNHSLSGCQGEMPNKPFTVKVTDSKGAVIVQKEMQSYRNGFIGVWLPRNMEGTLEVSYNGKTASHAIATSDDSQTCLTELPLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,858,629 | -1.74 | 0.07 | ●○○○○ -0.73 | -0.725955777667764 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,858,629 | 0.45 | 0.93 | ○○○○○ 0.41 | 0.41026026582519 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,858,629 | 0.78 | 0.33 | ○○○○○ 0.58 | 0.582684194689066 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,858,443 | 0.81 | 0.35 | ○○○○○ 0.6 | 0.596798400777786 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,858,443 | 1.01 | 0.63 | ○○○○○ 0.7 | 0.699349611318997 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,858,443 | 1.11 | 0.67 | ○○○○○ 0.76 | 0.755804975360878 | 23637626 |
Retrieved 6 of 6 entries in 1.5 ms
(Link to these results)