Bacterial taxon 909946
Locus STM474_3857
Protein WP_024131137.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 68 aa, Gene mtlA, UniProt E8XFZ9
>WP_024131137.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MFLPERAGVRLFPQPNPLHKGEDIAFIFRTADALALLAHPSHVLMYAPGDSLRCRLPAARTILGMLNC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,898,577 | 0.25 | 1 | ○○○○○ 0.31 | 0.306221905138327 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,898,577 | 1.38 | 0.09 | ○○○○○ 0.89 | 0.894066239611175 | 23637626 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)