Bacterial taxon 909946
Locus STM474_3908
Protein WP_001599866.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 59 aa, Gene n/a, UniProt E8XGT4
>WP_001599866.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MFCIVTGQGYGTHLISATACWTHIEISGLKRMWLRIIRTSDGYSYPDKAWIAIIPSSLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,948,692 | -5.27 | 3.8e-20 | ●●●○○ -2.56 | -2.56153251330135 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,948,671 | -1.7 | 0.21 | ●○○○○ -0.7 | -0.704553745572209 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,948,692 | -0.79 | 0.51 | ●○○○○ -0.23 | -0.230899500602726 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,948,671 | -0.44 | 0.58 | ●○○○○ -0.05 | -0.0525541287196536 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,948,671 | 0.18 | 1 | ○○○○○ 0.27 | 0.272966045562493 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,948,692 | 0.37 | 0.99 | ○○○○○ 0.37 | 0.371790305195488 | 23637626 |
Retrieved 6 of 6 entries in 1.7 ms
(Link to these results)