Bacterial taxon 909946
Locus STM474_3919
Protein WP_000745468.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 283 aa, Gene n/a, UniProt E8XGU5
>WP_000745468.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKKRCRQPETLRERCRHIFGDEPPVLNVWEAEFDYADAELQALAATDWRQITDWHLSVYYVLNLVYHEPMQPELFRYLFPLCLACWRETLLTHGYGDHFEESFLRALRRPYLWREMMDAAQRQQVRHFLLETMLARINHERGFNSPLTWLDTFNVLGGIAPFIRSLWNQWWLLDTPGKAVCALQYAAHLIYPVEVNPLWPEGSWQWQPPLGATEEPWLENNLAFLTRQLTSEMILDGVQKAAEMLRDEPESAMATRISRDALAAQDVIAIQIEDLLLALSRGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,960,645 | -3.48 | 0.00013 | ●●○○○ -1.63 | -1.63203784778685 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,960,376 | -1.84 | 0.068 | ●○○○○ -0.78 | -0.778664119287407 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,960,376 | -0.63 | 0.37 | ●○○○○ -0.15 | -0.151992282230252 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,960,645 | -0.08 | 0.92 | ○○○○○ 0.14 | 0.135011191539232 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,960,376 | 0.23 | 0.98 | ○○○○○ 0.3 | 0.297782463421139 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,960,645 | 0.9 | 0.77 | ○○○○○ 0.64 | 0.644407247351706 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)