Bacterial taxon 909946
Locus STM474_4023
Protein WP_000960001.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 75 aa, Gene int, UniProt E8XHT2
>WP_000960001.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLVFYSLLEEALESFLPILETSRIGRKLSSATLKVLNKLVSGETLDKAINQSLTLKSDVIMVEKCIFFNRLDSIF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,072,451 | -1.81 | 0.14 | ●○○○○ -0.76 | -0.760880892886385 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,072,561 | 0.35 | 0.79 | ○○○○○ 0.36 | 0.358300441077271 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,072,561 | 0.71 | 0.26 | ○○○○○ 0.55 | 0.54740421510255 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,072,451 | 0.74 | 0.39 | ○○○○○ 0.56 | 0.559922907719751 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,072,561 | 1.86 | 0.94 | ○○○○○ 1.14 | 1.14196476534796 | 23637626 |
Retrieved 5 of 5 entries in 0.7 ms
(Link to these results)