Bacterial taxon 909946
Locus STM474_4120
Protein WP_010989084.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 120 aa, Gene n/a, UniProt E8XIP8
>WP_010989084.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MFFVITHHIDVLPLATLPTHETCPYCNNQDVWLIIRQKRTRTCGLSQARKRDKFGLAICNHCSNEIKEKRWSPALRQLFTEQKPLFNLTFWQRYGFWVGWLSVWPALFLATWLYFTFRGW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,171,709 | -4.38 | 1.1e-14 | ●●●○○ -2.1 | -2.0961872093752 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,171,709 | -1.85 | 0.055 | ●○○○○ -0.78 | -0.784132849697339 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,171,709 | -0.64 | 0.8 | ●○○○○ -0.16 | -0.157824093086303 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,171,704 | 0.12 | 0.88 | ○○○○○ 0.24 | 0.237196053586775 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,171,875 | 0.23 | 0.98 | ○○○○○ 0.3 | 0.297194208111381 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,171,704 | 0.27 | 0.97 | ○○○○○ 0.32 | 0.319297522808083 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,171,875 | 0.69 | 0.85 | ○○○○○ 0.54 | 0.535117578269058 | 23637626 |
Retrieved 7 of 7 entries in 2 ms
(Link to these results)