Bacterial taxon 909946
Locus STM474_4122
Protein WP_001541792.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 83 aa, Gene n/a, UniProt E8XIQ0
>WP_001541792.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MQYRNLFCLFSLSLLLPPAWGCRLSESPHNVYQRQGSGVVYLQPEEENNLSLPEVSFKRLRRLPNSLINPATQGWNWIAQPPS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,173,149 | -0.12 | 0.97 | ○○○○○ 0.12 | 0.11634073722687 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,173,149 | 0.26 | 0.75 | ○○○○○ 0.31 | 0.313835045986038 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,173,149 | 0.39 | 0.68 | ○○○○○ 0.38 | 0.380547348891294 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)