Bacterial taxon 909946
Locus STM474_4180
Protein WP_001541209.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 74 aa, Gene n/a, UniProt E8XJI4
>WP_001541209.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSLPQKSKVMHIARTLTGSTTQDEGQERQEAKTQDCQEDKRPETLVKGNGNNMECSRLREKQGVLIANRDGGTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,231,571 | 0.29 | 0.98 | ○○○○○ 0.33 | 0.329127838914534 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,231,731 | 0.42 | 0.63 | ○○○○○ 0.4 | 0.39706544569268 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,231,571 | 0.87 | 0.3 | ○○○○○ 0.63 | 0.627399404050257 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,231,731 | 0.92 | 0.96 | ○○○○○ 0.66 | 0.657184303717141 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,231,731 | 1.4 | 0.55 | ○○○○○ 0.91 | 0.90554581670497 | 23637626 |
Retrieved 5 of 5 entries in 1.8 ms
(Link to these results)